PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn203151
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 328aa    MW: 34476.4 Da    PI: 8.9499
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn203151genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.28.9e-3971130362
      zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 e+alkcprC+st tkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+nkks+
  Achn203151  71 EAALKCPRCESTSTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKKSK 130
                 6789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-3059122IPR003851Zinc finger, Dof-type
PfamPF027014.2E-3273128IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.22774128IPR003851Zinc finger, Dof-type
PROSITE patternPS01361076112IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MVFSSIPIYV DPHNWPQQEG GGSQNSQFPP HGMPPPAGGG GGSTGTGSGS GSARPGSMAE  60
RARLAKVPLP EAALKCPRCE STSTKFCYFN NYSLTQPRHF CKTCRRYWTR GGALRNVPVG  120
GGCRRNKKSK KSRSKSPAPV ERLLVGSNST STNMISHLLP PPTQLPFCPS LPHLSDYGGS  180
GGIGLNFPGI QPPVAASGGC GTDVEFQIGG GSCGGRSILS ARFGDQWRLQ QLNQFSFLTG  240
MEPPPSGAYP FEGENVNSQA YTGAATGELG SRELDSGVAT VKVEESKGLN LSRNFLGAQG  300
NDQYWDGNNN TWTDLSGFAA SSTSHLL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1129135KKSRSKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002278642.11e-112PREDICTED: dof zinc finger protein DOF3.6 isoform X1
TrEMBLA5BZE71e-119A5BZE7_VITVI; Putative uncharacterized protein
STRINGVIT_13s0019g01410.t011e-107(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19172463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.15e-46OBF-binding protein 3